SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000092932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000092932
Domain Number 1 Region: 287-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-46
Family SPRY domain 0.0000707
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily RING/U-box 5.5e-23
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 89-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000443
Family B-box zinc-binding domain 0.0028
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000092932
Domain Number - Region: 138-209
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0667
Family C-terminal domain of PLC-beta 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000092932
Sequence length 467
Comment (Mus musculus)
Sequence
MAHVEVLARLQKETKCPICLDDLTDPVTVECGHNFCRSCIKDFWAGQQATSSCPVCRHQC
QHRNLRSNAQLGNMIETAQLLQGMENKRHESSTSCERHNQALTLFCEDDLQLLCDQCVEP
ESHGRHQVLSITEAASLHRKHLQDYSKLLKWEVKEIQGLMSALNKRTVTLREQAEAQRSQ
LTSECEKLMRFLDQEERAAFSRLEDEEMRLEKRLLDNIAALEHHGSSLRDLLRHLMLTGE
LSEAKMLSTVKDFYLNCRRQLISPSIFPVQLRRVEYSFPLQYSALQKVIQHFTDNVTLDL
KTAHPNLLISKDRTCVTFTKKRQRIPGSSSFTKSPVVLGIPHFNSGRHFWEVQVGKKPKW
AIGICKADSSIGERQSPNPWGYWRIVWQGDSFNVSGADPDSRLKAARATSIGVFLDYELG
EVSFYGMPEKCHLYTFRDTFSGPVCPYFYIGPQSEPLRLCSATDSEC
Download sequence
Identical sequences B2RTB3 Q3UWZ0
ENSMUSP00000092932 ENSMUSP00000092932 ENSMUSP00000092932 10090.ENSMUSP00000092932 NP_001028601.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]