SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000094056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000094056
Domain Number 1 Region: 957-1036
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00016
Further Details:      
 
Domain Number 2 Region: 566-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 710-787
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 4 Region: 1105-1178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 5 Region: 425-523
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000315
Family Eukaryotic type KH-domain (KH-domain type I) 0.0005
Further Details:      
 
Domain Number 6 Region: 780-855
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 7 Region: 1033-1107
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.00014
Further Details:      
 
Domain Number 8 Region: 349-419
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 
Domain Number 9 Region: 634-710
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.00033
Further Details:      
 
Domain Number 10 Region: 853-905,933-956
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000094056
Domain Number - Region: 98-142
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.067
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000094056
Sequence length 1250
Comment (Mus musculus)
Sequence
MNSKRNSASQQNKSAQKENHYKNPNDVVRMSRNDKEVNQHLEQGNFSGNPEETAESSNSN
IFKAGEISNLTRIFHVLLEEEKYLTQFGEGTLAKFYAHIMENTGVNLESSFVKDQGLYVT
VFGNPEAVTNAENEIFKWCQKQYLPLTLISKQEHCFFLNQTGNKSQDLEQEGQINTQITS
PHNQNNSINSVDVNQTKMKSSDGSLSTSARSNKGDIQILEMEKSFNPLTVKPYLQASDIF
QETEEHVPFELSSAKETDLDINEGQLHVDQIGCLKNDMIKKTSTITEGMMMTFQDSGTRS
LKRHFLEEILDTSEDSTGQSQSESISDYMTQHSDLDSSGELFNEADDNDDDYIASSIFAP
SWLHRFIIGTKGEEISEITECVPKVQIHFTAKDKITLKGPIDDVNYAQEKFDIIVKDLMS
KMEYTEINSDSKFYKYLTGNNGEILNRITEKNQVSITMFPENESNYSIRIEGESLGVHQA
KKELLDLANNLEEEYSQDIIIKHQFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDI
VQLIGPRYESEKCAQYLENMLTDIKENNYSISVPIIKKLHKRIIGKGVSNIRKISEATNT
KITFPPESCNSEEFIITGYPENCEIARNWILSLQQELADTAEEEIIIPANLYKHLTNPKE
CLLNSIIEECGKIHLHFPKGKSNLNKIIIMGTIENVEKAKTKLLKLSEEEQAKNYSETLH
IKSKYHQFLLNKNGGNISKICDETGTCVFFPNPTNKDQETITITGTEESVKEVQKQLDDL
VKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAK
PCVEAAKKHIKEIFEPLGSQITTRYVLPHSFQPFIMGPISSRIQQIARDYKVEIKFPDIE
KPALNMDLGTHEKGKEKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASIIPVTT
EVHVPLHLQPYIIGHKGSGLRKLVKEYEVHMQVSQPGKNSDIISIMGLSANVEQAKIKLQ
KRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEHDVTIHFPKKGTHD
MQEQITITGYKENTLAARDAIMRLLHKIEKTISKEITLNQQVRGNVIGVRGKTINKIMDQ
YQVDIRLPPKGLYNPNITVTGLADNVEKAIEHILNLEKYYLSAAINHGSQQEQPKSMSLC
NIAMTPSKSFVRKYVPCYAKTTTKLPDVDNCEHFPRLKQRTSSKTHPSKL
Download sequence
Identical sequences B1AXN3
ENSMUSP00000094056 ENSMUSP00000094056 NP_001028413.2.92730 10090.ENSMUSP00000094056 ENSMUSP00000094056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]