SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000095194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000095194
Domain Number 1 Region: 70-112
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000139
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000095194
Sequence length 114
Comment (Mus musculus)
Sequence
MCNEVEEQTVSTECWYIFISVFRFDKMSSTWIKFLFILTLVLLPYFVAESAVASPESLRK
VPNCTLYKSESDCSRTLIPVCADNQMTYYNACYFCLEQLVSPIKYKYHGICTKE
Download sequence
Identical sequences A0A0R4J158
NP_001041682.2.92730 10090.ENSMUSP00000095194 ENSMUSP00000095194 ENSMUSP00000095194 ENSMUSP00000095194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]