SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000100116 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000100116
Domain Number 1 Region: 25-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-27
Family V set domains (antibody variable domain-like) 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000100116
Sequence length 118
Comment (Mus musculus)
Sequence
MTMFSLALLLSLLLLCVSDSRAETTVTQSPASLSMAIGEKVTIRCITSTDIDDDMNWYQQ
KPGEPPKLLISEGNTLRPGVPSRFSSSGYGTDFVFTIENMLSEDVADYYCLQSDNLPL
Download sequence
Identical sequences 10090.ENSMUSP00000100116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]