SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000101061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000101061
Domain Number 1 Region: 1012-1116
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-30
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000101061
Domain Number - Region: 684-747
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0916
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000101061
Sequence length 1118
Comment (Mus musculus)
Sequence
MKKANRSAGSVPKVSGISKPQTVEKSKPENSSSAPTGVKPVRPGAAAALSKTKSNDDLLA
GMAGGVNVTNGIKAKKSTCSSAAPSAPAPAMTISENKSKISTGTSSSAKRSTSAGNKESS
STRERLRERTRLNQSKKLPSVSQGANDVALAKRSRSRTAAEGDIRMSKSKSDNQISDKAA
LEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGISEDHCEGEDRSEVKETIIAHQPTDV
ESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEIT
PGNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSS
DDALDAPSSSESEGVPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQ
ELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFGRQIEYFRSLLDEHHISYVI
DEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKE
RSHHMERIIESEQKGKAALAATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNS
GDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAK
KQIEDLNMTLEKLRSELEEKDTERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVK
KLQDQKHDMEREIKTLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLH
EAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTP
TVKTLIKSFDSASQVPNAAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLT
ALSDKRSNYGELPVQEHLLRTSSTSRPASLPRVPAMESAKTISVSRRSSEEMKRDISASE
GASPASLMAMGTTSPQLSLSSSPTASVTPSTRSRIREERKDPLSALAREYGGSKRNALLK
WCQKKTEGYQNIDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKKRNFTLAFQAA
ESVGIKSTLDINEMARTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences Q2KN98
ENSMUSP00000101061 NP_700455.3.92730 XP_006514315.1.92730 XP_017169616.1.92730 10090.ENSMUSP00000101061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]