SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000103537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000103537
Domain Number 1 Region: 721-815
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.96e-16
Family Tudor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 588-675
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000103537
Domain Number - Region: 776-887
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0112
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000103537
Sequence length 890
Comment (Mus musculus)
Sequence
MGCKTGPKPFGGGETIRPIRIRRCSYFTSTDSKMAIQLRSLFPLALPGMLALLGWWWFFS
RKKDRLSSSDKQVETLKVGPAIKDRRLSEEACPGVLSVAPTVTQPPGREEQRCVDKPSTE
PLALPRTRQVRRRSESSGNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIPLGCPLLP
KDASFPYEAVERCKQESALGKTPGRGWPSPYAASGEKARETGGTEGTGDAVLGENVSEEG
LLSQECVSEVEKSEFPILAPGGGEGEEVSHGPPQVAELLKKEEYIVGKLPSSFVEPVHSE
PVKDEDALEPQVKGSSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEEFRA
TTVGKTVAQVHPTSATQPKGKEESCVPASQETSLGQDTSDPASTRTGATASPSAEALPPK
TYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDNFVACMAN
NSQSVLSVSSLGQCSDPVSTSGLEDSCTETISSSGDKAMTPPLPVSTQPFSNGVLKEELS
DLGTEDGWTMDTEADHSGGSDGNSMDSVDSCCGLTKPDSPQSVQAGSNPKKVDLIIWEIE
VPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQNIQICHIEGSQHHVDKALNLIGK
KFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNAGHLFVQQHTHPTF
HALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVVASYEETNEVEIRY
VDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVVPLSDDDHFSPEADAAMSEMTGNT
ALLAQVTSYSATGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYASL
Download sequence
Identical sequences ENSMUSP00000122295 10090.ENSMUSP00000103537 ENSMUSP00000103537 ENSMUSP00000103537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]