SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000103704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000103704
Domain Number 1 Region: 57-157
Classification Level Classification E-value
Superfamily POZ domain 3.14e-29
Family Tetramerization domain of potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000103704
Sequence length 283
Comment (Mus musculus)
Sequence
MPHRKERPSGSSLNAHGSSGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKANAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTS
KLLLPDDFKDFNLLYEEARYYQLQPMVRELERWQQDQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRG
FSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD
Download sequence
Identical sequences Q8K0E1
ENSMUSP00000032709 ENSMUSP00000032709 ENSMUSP00000103704 ENSMUSP00000103705 ENSMUSP00000032709 10090.ENSMUSP00000103704 MmR346 NP_666300.1.92730 XP_006539963.1.92730 XP_006539964.1.92730 XP_006539965.1.92730 XP_006539966.1.92730 XP_006539967.1.92730 XP_006539968.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]