SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000105457
Domain Number 1 Region: 52-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-71
Family Calnexin/calreticulin 0.0000000422
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.94e-58
Family P-domain of calnexin/calreticulin 0.00000033
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000105457
Domain Number - Region: 401-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000269
Family Calnexin/calreticulin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105457
Sequence length 611
Comment (Mus musculus)
Sequence
MRFQGVGLCLGLLFITVNADFMDDGVEVEDFSENSDESNIKDEPSSGTFKYKTPQPIGEV
YFTETFDSGNLAGWVLSKAKKDDMDSEIAIYDGRWEIEELKENQVPGDRGLVLKSKAKHH
AIAAVLEKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTGDLILENFYDKTSYTIMF
GPDKCGEDYKLHLIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVMNPDDTFE
VLIDQKVVNQGTLLDDVVPPINPPREIDDPSDKKPEEWDDRAKIPDPTAVRPEDWDENEP
AQIEDSSAVKPDGWLDDEPKFIPNPKAEKPEDWSDDMDGEWEAPHIPNPACQIGCGEWKP
PMIDNPKYKGIWRPPMINNPNYQGLWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTP
DIYFDNFIICSEKEVADQWATDGWELKIMVANANEPGVLRQLVIAAEERPWLWLMYLVMA
GLPVALVASFCWPRKVKKKYEDTGPKKTELCKLQSKAALEQEAEEEKAPEKPEDVQEEKK
PGEAEVVTVEKEVIGEPEEKSKEDRETLEGQEEVSKLSKSGSEDEMKDADESPGSGDAPL
KSLRKRRVRKD
Download sequence
Identical sequences P52194
ENSMUSP00000002259 NP_034034.2.92730 XP_006530698.1.92730 XP_011246600.1.92730 10090.ENSMUSP00000105457 ENSMUSP00000002259 ENSMUSP00000105457 ENSMUSP00000002259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]