SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000105521
Domain Number 1 Region: 207-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.45e-26
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.34e-25
Family Calponin-homology domain, CH-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105521
Sequence length 678
Comment (Mus musculus)
Sequence
MANPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGLPGSGDGFLTGLATGT
TLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVASFIGWCRAELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRATPQVSSVPAA
EEDVTEIATVPGVPTRTPRMTPNDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSSTHRLPQQRTGTFSPQRGSPTP
SPRPGSPVPGSERRSSRPEVTPISLRGTKEGPETPLRPRDQLPPLPRSRRYSGDSDSSAS
SAQSGPMGARSDDSATGSRRERPSHRPTSCLPASPRRPTAPRSQSRDRLDRGRPRVAPGG
RGAQLSTSSPARRTRSQSREEQAVLMVRRDRDGQHSWVARGRGGGGSGGSGRSTPQTPRA
LSPAAPRPSRGPSPGPELAATPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAAAS
HTPMGSAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQPGESGRTANGLPGPRSQALSSSSD
EGSPYLAVGGALDATRSSLAGPEPSLTWARGRMDTQPDRKPSRIPTPRGPRRPSGPIELG
AWHAQHSVTPRTEPDSSM
Download sequence
Identical sequences Q8JZP9
ENSMUSP00000050275 10090.ENSMUSP00000105521 NP_001177337.1.92730 NP_653146.1.92730 ENSMUSP00000050275 ENSMUSP00000050275 ENSMUSP00000105521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]