SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000105563
Domain Number 1 Region: 22-151,185-292
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-77
Family Calponin-homology domain, CH-domain 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105563
Sequence length 1052
Comment (Mus musculus)
Sequence
MAAQEWDWFQREELIGQISDIRVQNLQVERENVQKRTFTRWINLHLEKCDPPLEVTDLFV
DIQDGKILMALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIA
DGNPSLVLGLIWNIILFFQIKELTGNLSRSSPSSSLSPGSGGTDSDSSYPPTPTTERSVA
VAVKDQRKAIKTLLSWVQRKTRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALE
DSTRDNLEKAFSIAHDSLHIPRLLEPEDIMVDMPDEQSIVTYVAQFLERFPELEPEDFVN
PDKEAPIESTFVRIKESPSEQGSRVLLLSENGERAYTVNQETSYPPPDKVFVCDQLESPT
GFCLDSAPSHKLSDSSTEFMHEIIDQVLQGSTGKTGSIAEPTPESSILSTRKDGRRSNSL
PVKKTVHFEADLHKDASCSKDPFYSSDFRFEGSPKATKELSKQDGHVSLAEVSKEKKKSE
QEARLVLEAASDKVPESTVDGLDAVPQDAQPSQDSSFCNGTVESPSSQGEKGPPPSSPGD
HTLLANSTELKVQLLTVEPMDKEDYFECIPLKASKFNRDLVDFASTSQAFGEDPSSHEKT
RGEEEGSENHAEKPGKRKSKSPRAETEAAESRLEPKKLEPPPKDPEQEDQGHALPPETPA
DKKPKVYEKAKRKSTRHHSEEEGEAESGFSAVCEEEIPSAPPSTSVSLETLRSHSEEGLD
FKPSPPLSKISVIPHDLFYYPHYEVPLAAVLEAYAEGGEDLKSEDTDLEHPEDSYLQDSR
EEEADEDEEEAQSSQSSCSFSLPVDNSYPSVSEHVSHVDGSSEGPTSALGPGSPPSHEDH
QPKETKENGPVESQQSQEPPNPELPTKPLEEKLTEASTSSKKKEKRKHMDHVESSLFIAP
GTVRSSDDLEENSSEHKVPSRNSHSDSSIYIRRHTNRSLELDHFSYVQLRNAADLDDRRN
RVLNRYNSQKLTELILQFYGIRADMKREYKHARLSMTGTNSSGEAVPLGNQSPPNDSLTQ
FVQQPDVIYFILFLWLLVYCLLLFPQLDVSRL
Download sequence
Identical sequences Q8C5W0
ENSMUSP00000105563 10090.ENSMUSP00000105563 ENSMUSP00000105563 ENSMUSP00000105563 NP_444385.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]