SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105638 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000105638
Domain Number 1 Region: 792-900
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.43e-31
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000105638
Domain Number - Region: 901-935
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00425
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105638
Sequence length 946
Comment (Mus musculus)
Sequence
MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELEREEEALASKRFRAERQD
NKENWLHSQQREAEQQAALARLAGRLESMNDVEELTTLLRSAGEYEERKLIRAAIRRVRA
QEIKAATLAGRLCSRLPSSGPREDSRRQAAHTLDPGKVPEPEQQEQQTEVLEPTPTPEDT
SQDVTTVTLLLRAPPGGRPSSPASPHNSPTSASPEPLLEPAGAQCPAVEAPVSSEPLPHP
SEAPSPEPPMSPVPSSSRGRVISKPLPGPTEPSDTLDSIRGFSNTKRADPSETKSCQRSL
SVLSPRQPTPNREPTSLAGPSQFRRVGSVRDRVQKFTSDSPVVARLQDGPPRTALASPTP
TRLPGPSLISTTPASSSSSNSSSPSPSDTSSHKKQRELAHSLAELQSCPQEEGPGGRGLA
LRSLENRAGGPKPCSEEPSTPPPVAVGTGEPGGSMKTTFTIEIKDGRGQASTGRVLLPTG
NQRAELTLGLRAPPTLLSTSSGGKNTITHISNPGTVTRLGSVTHVTTFSHASPGNRGGCN
FKMEPDPAEPPSTTVEAANGAEQARVDKGPEGRSPLSAEELTAIEDEGVLDKMLDQTTNF
EERKLIRAALRELRQRKRDQRDKERERRLREARARPGESRSNVATETTTRHSQRAADGST
VGTVTKTERLVHSNDGTQTARTTTVESSFMRRLENGSSSSSTTTTTVQTKSFSSSSSSSS
SKKMGSIFDREDQTSSRPGSLAALERRQAEKKKELMKAQSLPKTSASQARKAMIEKLEKE
GSAGGPGTPRTAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAF
CALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLREPDWKMLV
DCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRHELRLRGKNV
Download sequence
Identical sequences D3Z3Q3
ENSMUSP00000105638 ENSMUSP00000105638 10090.ENSMUSP00000105638 ENSMUSP00000105638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]