SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000105852
Domain Number 1 Region: 1011-1212
Classification Level Classification E-value
Superfamily vWA-like 2.52e-59
Family Integrin A (or I) domain 0.0000999
Further Details:      
 
Domain Number 2 Region: 147-338
Classification Level Classification E-value
Superfamily vWA-like 3.86e-57
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1230-1434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-33
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 4 Region: 448-614
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-22
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 740-910
Classification Level Classification E-value
Superfamily Fibronectin type III 9.63e-20
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 6 Region: 32-123,345-432
Classification Level Classification E-value
Superfamily Fibronectin type III 4.82e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 631-713
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000182
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 8 Region: 922-1006
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000134
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105852
Sequence length 1797
Comment (Mus musculus)
Sequence
MMIWQCKMRDWLILAFLAAACFCTIVRGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVAPASGGKTNQMNLQNTATKAIIQGLLPEQNYTVQLIAYYKDKESKPAQGQFRIKDL
EKRKDPTKPKVKVVDKGNGSKPTSPEEVKFFCETPAIADIVILVDGSWSIGRFNFRLVRN
FLENLVTAFNVGSEKTRIGLAQYSGDPRIEWHLNAFNTKDEVIDAVRSLPYKGGNTLTGL
ALNFIFENSFKPEAGSRSGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADL
SELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDKEIKASALATIGPPTEL
ITSEVTARSFMVNWTQSPGKVEKYRVVYYPTRGGKPEEVVVDGSVSSTVLKNLMSSTEYQ
IAVFAVSAHTASEGLRGAETTLALPMASDLELYDVTENSMRVRWDAVPGATGYLILYAPL
TEGLAGDEKEMKIGETHTDIELSGLFPNTEYTVTVYAMFGEEASDPATGQETTLPLTPPR
NLRISNVGSNSARLTWDPASGKISGYRIVYTSADGTEINEVEVDPITTFPLKGLTPLTEY
SIAIFSIYEEGQSLPLVGEFTTEEVPAQQYLEIDEVKTDSFRVTWHPLSAEEGQHKLMWI
PVYGGKTQEVDLKEEQDSYVIEGLDPGTEYEVSLLAVLDDGSESEVVTAVGTTLDDFWTE
APTAIEPTSPVTSVLQTGIRNLVVDDETATSLRVSWDISDSNVEQFRVTYLKAQGDPMEE
VGIQVMVPGVQNSLLLKALLPDTEYKVTVTPVYTVGEGVSVSAPGKTLPSSGPQNLRVSE
EWYNRVRITWDPPSGPVKGYRIVYKPVSVPGQTLETFVGADINTIVMTNLLSGMDYNVKI
FASQASGFSDALTGLVQTLFLGVTDLQANQVEMTSLCARWQIHRHATAYRIVLESLQDTQ
AQESTVGGGVNRHCFYGLQPDSEYKISVYTKLQELEGPSVSIMQKTQSLPTEPPTFPPTI
PPAKEVCKAAKADLVFMVDGSWSIGDDNFNKIINFLYSTVGALDKIGADGTQVAMVQFTD
DPRTEFKLDSYKTKETLLDAIRHISYKGGNTKTGKAIKHVRDTLFTSDSGTRRGIPKVIV
VITDGRSQDDVNKISREMQADGFNIFAIGVADADYSELVQIGSKPSSRHVFFVDDFDAFK
KIEDELITFVCETASATCPMVHKDGVDLAGFKMMEMFGLVEKDFSAVEGVSMEPGTFNLF
PCYQIHKDALVSQPTKYLHPEGLPSDYTMSFLFRILPDTPQEPFALWEILNKNSEPLVGI
ILDNGGKTLTYFNYDYTGDFQTVTFEGPDIRKMFYGSFHKLHVVVSKTLAKVVVDCKEVG
QKAINASANITSDGVEVLGRMVRSRGPNGNSAPFQLQMFDIVCSTSWASKDRCCELPGLR
DEESCPDLPRSCSCSETNEVALGPAGPPGGPGLRGPKGQQGEQGPKGPEGPRGETGPAGP
QGPPGPQGPSGLSIQGMPGMPGDKGDKGDAGLPGPQGVPGGVGSPGRDGSPGQRGFPGKD
GSSGPPGPPGPIGIPGAPGVPGITGSMGPQGALGPPGVPGAKGERGERGDLQSQAMVRAV
ARQVCEQLIQSHMARYTAILNQIPSQSSSIRTIQGPPGEPGRPGSPGTPGEQGPPGTPGF
PGNAGVPGTPGERGLTGVKGEKGNPGIGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPRG
PPGHLGVPGPQGPSGQPGYCDPSSCSAYGVGVSHPDQPEFTPVQDEQEAMDLWSAGI
Download sequence
Identical sequences 10090.ENSMUSP00000105852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]