SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000106811 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000106811
Domain Number 1 Region: 287-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-51
Family SPRY domain 0.0000951
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.55e-18
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000106811
Sequence length 484
Comment (Mus musculus)
Sequence
MAWRLTVPELQDQLQCPICLEVFKEPLMLQCGHSYCKDCLDNLSQHLDSELCCPVCRQSV
DCSSSPPNVSLARVIDALRLPGDIEPTVCVHHRNPLSLFCEKDQEFICGLCGLLGSHQHH
RVTPVSTVYSRMKEELAGRISELKEEHRNVEEHIGKLVNNRTRIINESDVFSWVIRREFQ
ELHHLVDEEKARCLEGLEGHTRGLVASLDMQLEQAQGTQERLAQAEQVLEQFGNESHHEF
IRKFHSVASRAEVQQARPLEGVFSPISFKPALHQADIKLTVWKRLFRKVLPAPASLKLDP
ATAHPLLELSKGNTVVHCGLLAQRRASQPERFDYSTCVLASKGFSWGRHYWEVVVGSKSD
WRLGVIKGTASRKGKLNKSPEHGVWLIGLKEGRVYEAFGCPRLPLPVAGHPHRIGVYLHY
EQGELTFFDADRPDDLRTLYTFQADFQGKLYPILDTCWHERGSNSLPMVLPPPSGPGHFT
LGQV
Download sequence
Identical sequences E9PVV5
ENSMUSP00000106811 ENSMUSP00000066662 XP_006504474.1.92730 ENSMUSP00000106811 10090.ENSMUSP00000106811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]