SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000108994 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000108994
Domain Number 1 Region: 313-596
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-69
Family Tandem AAA-ATPase domain 0.0000734
Further Details:      
 
Domain Number 2 Region: 67-144
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000108994
Sequence length 646
Comment (Mus musculus)
Sequence
MSRREPAANASSSGVAPRRSSTGSRGADRTATEETNRRGRVGSRGAGGGWREPAGAAEAT
AAGRREPPLCFGVKNDVVGAVIGRGGSKIREIQNTTNTRIQVIKGNPEAEIKIFGNKAMQ
TKAKTVIDNVVKKQQNYIPGQRVGIIAFQPTVGADTSTSESVTDDQPLIDWDQIREDALK
WEKKKWADLPPIKKNFYIESATTSSMSQVQIDNWRKENFNITCDDLKDGEKRPIPNPICK
FEDAFQSYPEVMENIKRAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLSYLMPGFI
HLDSQPLAREQRNGPGMLVLTPTRELALQVEAECSKYSYGDLKSVCVYGGGDRDGQIQDV
SKGVDIIIATPGRLNDLQMNNFVNLKSVTYLVLDEADKMLDMGFEPQIMKILLDVRPDRQ
TIMTSATWPYAVRRLAQSYLKEPMIVYVGTLDLVAVSTVKQNIIITTEEEKRTHIQTFLE
NMSPKDKVIVFVSRKAVADHLSSDLILRHISVESLHGNREQSDREKALENFKTGKVRILI
ATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDWRVATEL
INILERANQNIPEELVLMAERYKANKLKREMEKKMGRPQGKPQKFY
Download sequence
Identical sequences D3Z6P9
10090.ENSMUSP00000108994 ENSMUSP00000108994 ENSMUSP00000108994 NP_001177973.1.92730 ENSMUSP00000108994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]