SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000109304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000109304
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Histone-fold 4.02e-24
Family TBP-associated factors, TAFs 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000109304
Sequence length 212
Comment (Mus musculus)
Sequence
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHVDGDKGPRRWTVPSRRGRK
PGSSGRKNGGTGSKGKDKKLSGTDSEQEDESEDTDTDGEEETPQLPPQASHPPAHFQSPP
TPFIPFTSPLPLPPAPPGPSAADAEDEEDYDS
Download sequence
Identical sequences D3YY09
ENSMUSP00000109304 ENSMUSP00000109304 10090.ENSMUSP00000109304 ENSMUSP00000109304 NP_001278009.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]