SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000109633 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000109633
Domain Number 1 Region: 8-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-78
Family Calponin-homology domain, CH-domain 0.000000877
Further Details:      
 
Domain Number 2 Region: 3078-3201
Classification Level Classification E-value
Superfamily EF-hand 8.18e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 3 Region: 3203-3299
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 998-1154
Classification Level Classification E-value
Superfamily Spectrin repeat 8e-23
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 3279-3367
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 2053-2210
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 7 Region: 2518-2679
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-19
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1215-1369
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 2744-2871
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-18
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 10 Region: 337-449
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 2894-3032
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-18
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 12 Region: 524-662
Classification Level Classification E-value
Superfamily Spectrin repeat 5.25e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 13 Region: 1521-1640
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000112
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 14 Region: 2267-2414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000205
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 15 Region: 778-903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000213
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 16 Region: 1825-1967
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000049
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 17 Region: 1650-1774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000654
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 18 Region: 457-558
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000109
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 19 Region: 3040-3077
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 2457-2532
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000338
Family Spectrin repeat 0.005
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000109633
Domain Number - Region: 1429-1557
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000863
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number - Region: 922-1012
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000863
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000109633
Sequence length 3678
Comment (Mus musculus)
Sequence
MLWWEEVEDCYEREDVQKKTFTKWINAQFSKFGKQHIDNLFSDLQDGKRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKTIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTSSWSDGLALNALIHSHRPDL
FDWNSVVSQHSATQRLEHAFNIAKCQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLP
QQVSIEAIQEVEMLPRTSSKVTREEHFQLHHQMHYSQQITVSLAQGYEQTSSSPKPRFKS
YAFTQAAYVATSDSTQSPYPSQHLEAPRDKSLDSSLMETEVNLDSYQTALEEVLSWLLSA
EDTLRAQGEISNDVEEVKEQFHAHEGFMMDLTSHQGLVGNVLQLGSQLVGKGKLSEDEEA
EVQEQMNLLNSRWECLRVASMEKQSKLHKVLMDLQNQKLKELDDWLTKTEERTKKMEEEP
FGPDLEDLKCQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGD
RWANICRWTEDRWIVLQDILLKWQHFTEEQCLFSTWLSEKEDAMKNIQTSGFKDQNEMMS
SLHKISTLKIDLEKKKPTMEKLSSLNQDLLSALKNKSVTQKMEIWMENFAQRWDNLTQKL
EKSSAQISQAVTTTQPSLTQTTVMETVTMVTTREQIMVKHAQEELPPPPPQKKRQITVDS
ELRKRLDVDITELHSWITRSEAVLQSSEFAVYRKEGNISDLQEKVNAIAREKAEKFRKLQ
DASRSAQALVEQMANEGVNAESIRQASEQLNSRWTEFCQLLSERVNWLEYQTNIITFYNQ
LQQLEQMTTTAENLLKTQSTTLSEPTAIKSQLKICKDEVNRLSALQPQIEQLKIQSLQLK
EKGQGPMFLDADFVAFTNHFNHIFDGVRAKEKELQTIFDTLPPMRYQETMSSIRTWIQQS
ESKLSVPYLSVTEYEIMEERLGKLQALQSSLKEQQNGFNYLSDTVKEMAKKAPSEICQKY
LSEFEEIEGHWKKLSSQLVESCQKLEEHMNKLRKFQNHIKTLQKWMAEVDVFLKEEWPAL
GDAEILKKQLKQCRLLVGDIQTIQPSLNSVNEGGQKIKSEAELEFASRLETELRELNTQW
DHICRQVYTRKEALKAGLDKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVE
EMKRAKEEALQKETKVKLLTETVNSVIAHAPPSAQEALKKELETLTTNYQWLCTRLNGKC
KTLEEVWACWHELLSYLEKANKWLNEVELKLKTMENVPAGPEEITEVLESLENLMHHSEE
NPNQIRLLAQTLTDGGVMDELINEELETFNSRWRELHEEAVRKQKLLEQSIQSAQEIEKS
LHLIQESLEFIDKQLAAYITDKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKDANQ
RVLSQIDVAQKKLQDVSMKFRLFQKPANFEQRLEESKMILDEVKMHLPALETKSVEQEVI
QSQLSHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAK
VTERKQQLEKCLKLSRKMRKEMNVLTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQ
KEIEKQKAHLKSVTELGESLKMVLGKKETLVEDKLSLLNSNWIAVTSRVEEWLNLLLEYQ
KHMETFDQNIEQITKWIIHADELLDESEKKKPQQKEDILKRLKAEMNDMRPKVDSTRDQA
AKLMANRGDHCRKVVEPQISELNRRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLE
AEIQQGVNLKEEDFNKDMSEDNEGTVNELLQRGDNLQQRITDERKREEIKIKQQLLQTKH
NALKDLRSQRRKKALEISHQWYQYKRQADDLLKCLDEIEKKLASLPEPRDERKLKEIDRE
LQKKKEELNAVRRQAEGLSENGAAMAVEPTQIQLSKRWRQIESNFAQFRRLNFAQIHTLH
EETMVVTTEDMPLDVSYVPSTYLTEISHILQALSEVDHLLNTPELCAKDFEDLFKQEESL
KNIKDNLQQISGRIDIIHKKKTAALQSATSMEKVKVQEAVAQMDFQGEKLHRMYKERQGR
FDRSVEKWRHFHYDMKVFNQWLNEVEQFFKKTQNPENWEHAKYKWYLKELQDGIGQRQAV
VRTLNATGEEIIQQSSKTDVNILQEKLGSLSLRWHDICKELAERRKRIEEQKNVLSEFQR
DLNEFVLWLEEADNIAITPLGDEQQLKEQLEQVKLLAEELPLRQGILKQLNETGGAVLVS
APIRPEEQDKLEKKLKQTNLQWIKVSRALPEKQGELEVHLKDFRQLEEQLDHLLLWLSPI
RNQLEIYNQPSQAGPFDIKEIEVTVHGKQADVERLLSKGQHLYKEKPSTQPVKRKLEDLR
SEWEAVNHLLRELRTKQPDRAPGLSTTGASASQTVTLVTQSVVTKETVISKLEMPSSLLL
EVPALADFNRAWTELTDWLSLLDRVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQL
EELITAAQNLKNKTSNQEARTIITDRIERIQIQWDEVQEQLQNRRQQLNEMLKDSTQWLE
AKEEAEQVIGQVRGKLDSWKEGPHTVDAIQKKITETKQLAKDLRQRQISVDVANDLALKL
LRDYSADDTRKVHMITENINTSWGNIHKRVSEQEAALEETHRLLQQFPLDLEKFLSWITE
AETTANVLQDASRKEKLLEDSRGVRELMKPWQDLQGEIETHTDIYHNLDENGQKILRSLE
GSDEAPLLQRRLDNMNFKWSELQKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDE
LSRQAPIGGDFPAVQKQNDIHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQE
PRELPPEERAQNVTRLLRKQAEEVNAEWDKLNLRSADWQRKIDEALERLQELQEAADELD
LKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVNRVNDLAHQLTTLGI
QLSPYNLSTLEDLNTRWRLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGPWERAISP
NKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLS
AACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYD
TGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQ
LGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETA
KHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGE
DVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQ
LSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQ
PRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMP
TSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVN
GTTVSSPSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQLNNSF
PSSRGRNAPGKPMREDTM
Download sequence
Identical sequences P11531
ENSMUSP00000109633 ENSMUSP00000109624 NP_031894.1.92730 10090.ENSMUSP00000109633 ENSMUSP00000109633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]