SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000109803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000109803
Domain Number 1 Region: 334-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-50
Family SPRY domain 0.0000933
Further Details:      
 
Domain Number 2 Region: 32-144
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-19
Family V set domains (antibody variable domain-like) 0.00039
Further Details:      
 
Domain Number 3 Region: 119-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000728
Family C1 set domains (antibody constant domain-like) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000109803
Sequence length 586
Comment (Mus musculus)
Sequence
MENHRKPSLLFHVPCLFVLTQLLSWVTTQEFRVFGPSDPIVAAPGGEAILPCSVFPAMNV
ENMEELRWFRSRFSEAVLFYRDQEEQKEGQMPGYSQRTLLVKDQFHQGTAAVRILNVQAS
DSGIYICHFQQGVFYDEAILELKVAAMGSVPEVHIKGPEDGGVCVVCMTSGWYPEPQVHW
KDSRGENLTAFSSETHTKDAEGLFSTETLLVVRDSSVRNVTCSIFNPILGQEKATAMFIP
EPFFPQASPWKPAFLVTLTMMGLLVLGTSYLLRREHSARLKVQQETVNFQREKDESLKTR
DDALSFSGALMVERDRRKAAYRAAWKKAQLYADWRKEHFEAWTFTLDPASAHPILAISPD
RLSVSRKDSTLCLDDLFCVLGIRGISSGRHYWEVKLRNGDSSKWTLGVCREGVDRKGCFS
ECPHKGFWTVGRSSSGYLAYIDTGTALLSLRQAPQSVGVFVDYTEGDISFYNMSDMSPMF
SFHEASFSGTLFPYFRLKSGNVSMIIQSMACASEGREGEDRRRGRKRSRKGRKGKRTKRG
KKLVLLPLEESLSPAGEGLVPGSCVVDSFPEEVSPFLQHARNSLFP
Download sequence
Identical sequences 10090.ENSMUSP00000109803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]