SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000110663 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000110663
Domain Number 1 Region: 48-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-71
Family Lectin leg-like 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000110663
Sequence length 358
Comment (Mus musculus)
Sequence
MAAASRPSWWQRWRRRAWARDGAKLLLFLLLLGSGPGPRHVRAGQAVEYLKREHSLSKPY
QGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLKDWELQVHFKIHGQG
KKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQHEAQKRRYSPGVQR
VFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNIRYDTFLVIRYVKRHLTIMMDIDG
KHEWRDCIEMPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTGVRTPEEEKLHRDVF
LPSVDNLKLPEMTVPPTPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQDQSRKRFY
Download sequence
Identical sequences D3Z4P2
ENSMUSP00000110663 ENSMUSP00000117200 ENSMUSP00000110663 NP_001297446.1.92730 10090.ENSMUSP00000110663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]