SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000114931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000114931
Domain Number 1 Region: 316-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-34
Family SPRY domain 0.0016
Further Details:      
 
Domain Number 2 Region: 155-266
Classification Level Classification E-value
Superfamily Fibronectin type III 8.83e-16
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000114931
Domain Number - Region: 8-115
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000301
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000114931
Sequence length 497
Comment (Mus musculus)
Sequence
MDSQKEALQRIISTLANKSDEIQNFIDTLNHTLKGVQENSSNILSELDEEFDSLYSILDD
VKESMISTIKQEQVRKSQELQSQLSQCNNALENSEELLEFATRSLDIKEPEEFSKAARQI
KDRVTMASAFRLSLKPKVSDNMTHLMVDFSQERQMLQTLKFLPVPKAPEIDPVECLVADN
SVTVAWRMPEEDNKIDHFIMEYRKTNFDGLPRVKDERCWEVIDNIKGTEYTLSGLKFDSK
YMNFRVRACNKAVAGDYSDPVTLETRALNFSLDNSSSHLNLKVEDSCVEWDPTGGKGQES
KIKGKENKGRSGTPSPKRTSVGSRPPAVRGSRDRFTGESYTVLGDTAIENGQHYWEVKAQ
KDCKSYSVGVAYKTLGKFDQLGKTNTSWCVHVNSWLQNTFAAKHNNKVKALDVPVPEKIG
VFCDFDGGQLSFYDAHSKQLLYSFKTKFTQPVVPGFMVWCGGLSLSTGMQVPSAVRTLQK
SENGMTGSTSSLNNVTQ
Download sequence
Identical sequences ENSMUSP00000114931 NP_001182213.1.92730 10090.ENSMUSP00000114931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]