SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000000058 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000000058
Domain Number 1 Region: 22-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.96e-42
Family Pentraxin (pentaxin) 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000000058
Sequence length 230
Comment (Rattus norvegicus)
Sequence
MEKLLWCLLITISFSQAFGHEDMSKQAFVFPGVSATAYVSLEAESKKPLEAFTVCLYAHA
DVSRSFSIFSYATKTSFNEILLFWTRGQGFSIAVGGPEILFSASEIPEVPTHICATWESA
TGIVELWLDGKPRVRKSLQKGYIVGTNASIILGQEQDSYGGGFDANQSLVGDIGDVNMWD
FVLSPEQINAVYVGRVFSPNVLNWRALKYETHGDVFIKPQLWPLTDCCES
Download sequence
Identical sequences H6X2W5 P48199
10116.ENSRNOP00000000058 ENSRNOP00000000058 NP_058792.1.100692 NP_058792.1.4139 ENSRNOP00000000058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]