SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000000767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000000767
Domain Number 1 Region: 738-912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-41
Family MAM domain 0.00029
Further Details:      
 
Domain Number 2 Region: 441-541
Classification Level Classification E-value
Superfamily Immunoglobulin 3.9e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 241-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000255
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 346-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000321
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 49-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000475
Family I set domains 0.06
Further Details:      
 
Domain Number 6 Region: 536-627
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000777
Family I set domains 0.036
Further Details:      
 
Domain Number 7 Region: 152-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000869
Family I set domains 0.035
Further Details:      
 
Domain Number 8 Region: 591-732
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000153
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000000767
Sequence length 949
Comment (Rattus norvegicus)
Sequence
MDLVYGLVWLLTVLLEGISGQGVYAPPTVRIVHSGLACNIEEERYSERVYTIREGETLEL
TCLVTGHPRPQIRWTKTAGSASDRFQDSSVFNETLRITSIQRHQGGRYYCKAENGLGSPA
IKSIRVDVYYLDDPVVTVHQSIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQ
GSDKGVEIYEPFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKTA
SPSIKLLVDDPIVVNPGEAITLVCVTTGGEPMPSLTWVRSFGTLPEKIVLNGGTLTIPAI
TSDDAGTYSCIANNNVGNPAKKSTNIIVRALKKGRFWITPDPYHKDDNIQIGREVKISCQ
VEAVPSEELTFSWFKNGRPLRSSERMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVAS
LKGGGISDISIDVNISSSTVPPNLTVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRA
DKEVAMPDGTMQMESYDGTLRIVNVSREMSGMYRCQTSQYNGFNVKPREALVQLIVQYPP
AVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYPLKS
LSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQM
NPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELITYNLTELIKPEAYEVRLTPL
TKFGEGDSTIRVIKYTGEFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKYTPNTGPN
ADRSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGPTNSAYCFSFFYHMYGQH
IGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGIRGPGIEGDI
AIDDVSIAEGECAKQDLPTKNSVDGAVGILVHIWLFPVIILISILSPRR
Download sequence
Identical sequences P60756
10116.ENSRNOP00000000767 NP_954890.1.100692 NP_954890.1.4139 NYSGRC-IgSF-ENSRNOP00000000767 ENSRNOP00000000767 ENSRNOP00000000767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]