SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000001372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000001372
Domain Number 1 Region: 34-131
Classification Level Classification E-value
Superfamily POZ domain 1.3e-28
Family Tetramerization domain of potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000001372
Sequence length 259
Comment (Rattus norvegicus)
Sequence
MERKIIRREKEREYEGRHNSLEDAEQGKNCTSTLTTLNVGGYLYITQRQTLTKYPDTFLE
GIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLK
GLAEEVKSRWKKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRL
DGFPEEFSVSSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLT
SLDCSKGSIVHSDALHFIK
Download sequence
Identical sequences D3ZXL9
RnR319 ENSRNOP00000001372 NP_001103120.1.100692 NP_001103120.1.4139 XP_006252392.1.100692 10116.ENSRNOP00000001372 ENSRNOP00000065668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]