SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000001899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000001899
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 2.27e-40
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 2 Region: 540-634
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-26
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000001899
Sequence length 686
Comment (Rattus norvegicus)
Sequence
MAAAVAGPLAAGGEEAAASVSVPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQLDVSSNELQSLPVELCS
LRSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQICLKGKLHIFKYLTMEAGRRGAALGDLVPSRPPSFSPCPAEDLFPGRRYDGGLDS
GFHSVDSGSKRWSGNESTDDFSELSFRISELAREPRGPRQPREDGSGDGDLEQIDFIDSH
VPGDDEQSAAEVRTQEPLPSELSLAAGDMERPSSSRREEPAGEERRRPDTLHLWQERERR
LQQQSGAWGPSKKDSIPKRGIRATGAGASAPSTQTACNGPPKSSAAQLGVSGEQGAPTLP
STSQDPLPVSGPVTAPVPRPLGSIQRPNSFLFRSSSQSGSSPSSPESVLRPRPFPQILEE
KELISQLRQILESRLQQPLPEDLAEALANGVILCQLANQLRPRSVPFIHVPSPAVPKLSA
LKSRKNVENFLEACRKMGVPEADLCSPSDLLRGTAQGLQTILEAVILAGGKAPVPVQPPS
GLGGFLLFYVVSMLLLYVVYTRLLGS
Download sequence
Identical sequences E9PSW6
10116.ENSRNOP00000001899 ENSRNOP00000001899 ENSRNOP00000001899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]