SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000003251 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000003251
Domain Number 1 Region: 687-781
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.66e-16
Family Tudor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 554-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000003251
Domain Number - Region: 742-850
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0275
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000003251
Sequence length 856
Comment (Rattus norvegicus)
Sequence
SKMAIQFRSLFPLALPGMLALLGWWWFFSRKKDRLSSNGKQVGTLKVGPAIEDRLPTEEA
CPGVLSVTPSVTQPPGKEEQRSMDRPLTDPPALPRTRQVRRRSESSGNLPSIVDTRLQAG
QCRDENSKVVLSLMGDEAKSIPLGRPLFPKDLSFPYEAVEGCKQESALGRTPGRGWLSQC
AASGENARETGGAEGTGDAVLGESVLEEGLLPQECVSEVEKSEFPILAPGGGGGEKVRSG
PPQVDELLKKEEYIVGKLPSSFVGPVHSELVKDEGALVPQVKGSQDRSLARELDKDKTLP
EKDQIEQTAFQIISQVILEATEEIRATTVGKTVAQVHPTPGTQPQGQEESCVPASQETSL
GQEIPDPASTRTGATASPSAGAPPPKTYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPPP
VTPQRQSLDGASNPRGDDTFVTCTSNNSQSVLSVTSLGLCSDPVSTSRLEDSCTETISSS
GDKAVTPPLPDSTEPFSNGVLKEELSDLGTEDGWTMDTEADHSGGSDGNSMDSVDSCCGL
TKPDSPQTVQAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLP
YTQNIQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDG
ITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAA
PGADGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLD
SVVPLSDDDHFSPEADAAMSEMTGNTALLAQVTSYSATGLPLIQLWSVVGDEVVLINRSL
VERGLAQWVDSCYASL
Download sequence
Identical sequences 10116.ENSRNOP00000003251 ENSRNOP00000052543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]