SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000004694 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000004694
Domain Number 1 Region: 20-196
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.77e-70
Family MHC antigen-recognition domain 0.0000041
Further Details:      
 
Domain Number 2 Region: 201-282
Classification Level Classification E-value
Superfamily Immunoglobulin 5.9e-23
Family C1 set domains (antibody constant domain-like) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000004694
Sequence length 343
Comment (Rattus norvegicus)
Sequence
MMFLLPFLTVFLAKQSHTRTHSLRYFRLAISDPGPGVPEFISVGYVDSHPITTYDSVTRQ
KEPRAPWMAENLAPDHWERYTQLLRGWQRTFQTELRHLQRHYNHSGLHTYQRMIGCELLE
DGSTTGFLQYAYDGQDFIVFDKDTLSWLAMDNVAHITKRAWEANLHELQYQKNWLEEECI
AWLKRFLEYGSDALERTEHPVVRTTRKETFPGITTLFCRAHGFYPPEISMIWKKNGEEIV
QEVDYGGVLPSGDGTYQMWVSVDLDPQTKDIYSCHVEHCGLQMVLEAPQESGNTLLVANT
ISGTIILIIVLAGVGALIWRRRSREPKEVMYQPTQVNEGSSPS
Download sequence
Identical sequences O19477
NP_001094105.1.100692 NP_001094105.1.4139 10116.ENSRNOP00000004694 ENSRNOP00000004694 NYSGRC-IgSF-ENSRNOP00000004694 ENSRNOP00000004694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]