SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000004703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000004703
Domain Number 1 Region: 296-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-37
Family Pentraxin (pentaxin) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000004703
Sequence length 494
Comment (Rattus norvegicus)
Sequence
LKFLAVLLAAGMLAFLGAVICIIASVPLAASPARALPGGTDNASAASAAGAPGPQRSLSA
LQGAGGSAGPSVLPGEPAASVFPPPPGPLLSRFLCTPLAAACPSGAEQGDAAGERAELLL
LQSTAEQLRQTALQQEARIRADRDTIRELTGKLGRCESGLPRGLQDAGPRRDTMADGAWD
SPALLVELENAVRALRDRIERIEQELPARGNLSSSAPAPAVPTALHSKMDELEGQLLAKV
LALEKERAALSHGSHQQRQEVEKELDALQGRVAELEHGSSAYSPPDAFKVSIPIRNNYMY
ARVRKAVPELYAFTACMWLRSRSGGSGQGTPFSYSVPGQANEIVLLEAGLEPMELLINDK
VAQLPLSLKDSNWHHICIAWTTRDGLWSAYQDGELRGSGDNLAAWHPIKPHGILILGQEQ
DTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTGPLMGNVLPWEDKLVEAFGGA
KKAAFDVCKGRAKA
Download sequence
Identical sequences F1LSY2
10116.ENSRNOP00000004703 ENSRNOP00000004703 ENSRNOP00000052999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]