SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000004873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000004873
Domain Number 1 Region: 491-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-49
Family SPRY domain 0.00068
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000108
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 4 Region: 372-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000116
Family Fibronectin type III 0.0024
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000004873
Domain Number - Region: 109-161
Classification Level Classification E-value
Superfamily RING/U-box 0.0009
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000004873
Sequence length 680
Comment (Rattus norvegicus)
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESINAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMSSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQERRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVNIACDCTCLVGFAGLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAIN
QAGSRSSEPGKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGS
YGVAGNVFIDSGRHYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVR
HNSKEIPIEPAPHPRRVGILLDYDNGSIAFYDALNSIHLYTFDVALAQPVCPTFTVWNKC
LTIITGLPIPDHLDCTEQLP
Download sequence
Identical sequences 10116.ENSRNOP00000004873 ENSRNOP00000004873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]