SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000004912 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000004912
Domain Number - Region: 13-21
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000004912
Sequence length 178
Comment (Rattus norvegicus)
Sequence
MAASLGGMFAGQPPGPPPPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLV
SQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRS
ELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADMPQGSLAYLEQASANIPAPLKQT
Download sequence
Identical sequences P68943
ENSRNOP00000004912 NP_001100687.1.100692 NP_001100687.1.4139 ENSRNOP00000004912 10116.ENSRNOP00000004912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]