SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000005163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000005163
Domain Number 1 Region: 24-152
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-44
Family Regulator of G-protein signaling, RGS 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000005163
Sequence length 158
Comment (Rattus norvegicus)
Sequence
MSRHICWICKLCRHESKRLPSNLTLDEVLKWAQSLESLMATKYGPVVYTAYLKLEHSDEN
IKFWMACETYKKIASRRGRISRAKKLYNLYIQPQSPREINIDSTTREAIIKSIREPTQTC
FEEAQKIVYMHMEMDSYPRFLKSEMYQKLLKTVQSKSC
Download sequence
Identical sequences D3ZCS1
10116.ENSRNOP00000005163 ENSRNOP00000005163 XP_017454472.1.100692 XP_017454473.1.100692 XP_017460117.1.4139 XP_017460118.1.4139 ENSRNOP00000005163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]