SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000005384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000005384
Domain Number 1 Region: 138-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000005384
Sequence length 387
Comment (Rattus norvegicus)
Sequence
MATSVDTPAKEARKSDSRQQKQKRENQDEGELLTVPDGWKEPAFSKEDNPRGLLEESSFA
TLFPKYREAYLKECWPLVQKALNEHHVKATLDLIEGSMTVCTTKKTFDPYIIIRARDLIK
LLARSVSFEQAIRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNC
YVMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKTLMIKRELAKDSELRSQSWER
FLPQFKHKNVNKRKEPKKKSVKKEYTPFPPPQPESQVDKELASGEYFLKANQKKRQKMEA
IKAKQAEALTKRQEERNKAFIPPKEKPAVQRKLLLKRRLMWLPSRKRLRRRRPRSWALLQ
QRKLSSRWRLTKRSRREKSNIGKTRTF
Download sequence
Identical sequences ENSRNOP00000059249 10116.ENSRNOP00000005384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]