SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000005866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000005866
Domain Number 1 Region: 67-197
Classification Level Classification E-value
Superfamily TNF-like 2.73e-29
Family TNF-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000005866
Sequence length 198
Comment (Rattus norvegicus)
Sequence
MGSARRALSVVPAVLLVLVLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGIS
VRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFS
FHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGN
LLGGWQYSTFSGFLVFPL
Download sequence
Identical sequences D4ABJ2
ENSRNOP00000005866 ENSRNOP00000005866 10116.ENSRNOP00000005866 NP_001102680.1.100692 NP_001102680.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]