SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000006610 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000006610
Domain Number 1 Region: 677-917
Classification Level Classification E-value
Superfamily HCP-like 1.57e-31
Family HCP-like 0.0014
Further Details:      
 
Domain Number 2 Region: 889-1004
Classification Level Classification E-value
Superfamily HCP-like 0.00000000916
Family HCP-like 0.01
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000006610
Domain Number - Region: 290-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000902
Family Laminin G-like module 0.064
Further Details:      
 
Domain Number - Region: 560-649
Classification Level Classification E-value
Superfamily HCP-like 0.0562
Family HCP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000006610
Sequence length 1136
Comment (Rattus norvegicus)
Sequence
MQWRGAGLWWPRRRQQQQQQPPPPAFGPRAAAMVPPSGGVPLSLGGRPASALLFLCYLNF
VPSLGRQTSLTTSVLPRTEQSTTYTDFIYFTAFEGSVRNVSEVSVEYLCSQPCVVNLEAV
VSSEFRSSIPVYKKRWRNEKHLHTSRTQIVHVKFPSIMVYRDDYLIRHPISVSPVILRAW
ITHWHSGGGLNVRGEENLLHAVAKNYTLLQTVPPFERPFKDHQVCLEWNMDYLWSLWANR
IPQCPLESDAVPLLSFPYASSGENTGIVKKLPKFQNRELEATRSQRVDYPMVTISLWLYL
LHYCEASLCGILYFVDSNEMYGTPSVFLTEDGSLHIQMHLIKGEDLAVKTKFTLPLKEWC
RLDISFNGGQIVVTASIGWDLKSYHNQTISFHEDFYYNDTAGYFVVGGSRYVAGIEGFFG
PVKYYRLRSLHPAQVLNPFLEKELAEQIKLYYEHCAEVWDIISSYTATVQAGGERRETCD
FRNSYLDLKRKYGRAEVCRALPWEKGLRDRHPSLFQTLLQMDLLTAPRNQNDSVLEIGAR
IFEKAVKRLSGVDGLHQISSAVPLLMYSSCCGYHKASYYLTVFYETGLNGPRDQLQGMLY
SLVGGQGSERLSSMNLGYKHYQGVDSYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVE
TIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIEW
YAKGALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWYYHKF
RKNYAKAAKYWLKAEEMGNPDASYNLGVLYLDGIFPGLPGRNLTLAGEYFHKAAQGGHIE
GTLWCSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKGLNAYLEGLWHEALLY
YVLAAETGIEVSQTNLAHICEERPDLAGRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGDL
YYYGHQNQSQDLELSVQMYAQAALDGDSQGFFNLAALIEEGAVIPHHILEFLEIDPSLHP
SNTSILRELYERCWSLGNEESLSPCSLALLYLHLRLLCGALMHSTLIYFLGTFLLSVVIA
WMVLYLQCVSASGSSPAPAWVLADPASSTPSPAVPPAADASDHDPPMMANNPEPRG
Download sequence
Identical sequences XP_341224.5.100692 ENSRNOP00000006610 10116.ENSRNOP00000006610 ENSRNOP00000006610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]