SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000011869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000011869
Domain Number 1 Region: 23-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000982
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 
Domain Number 2 Region: 125-212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000323
Family C1 set domains (antibody constant domain-like) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000011869
Sequence length 279
Comment (Rattus norvegicus)
Sequence
MWSLWSLLLFQGLLPIVVISVQVLSKVGDSGLLVAECPPGFQVREAIWRSLWPSEELLAT
FFRGSLETLYHSRFLGRVQLYDNLSLELGPLRTGDSGNFSVLMVDTGGQTWTQTLHLKVY
DAVPKPEVQVFTAATEEAQPLNTCQVFLSCWAPNISDITYSWRREGTMDFNGELRSLFSN
GQVLSVSLGLGDKDVAFTCIASNPVSWDMTTVTPWESCHHEAASSGKASYKDVLLVVMPI
TLFLILAGLFGAWHHGLCSGKRKDACTDRALPETESAVA
Download sequence
Identical sequences D3ZS24
NYSGRC-IgSF-ENSRNOP00000011869 ENSRNOP00000011869 NP_001099443.1.100692 NP_001099443.1.4139 10116.ENSRNOP00000011869 ENSRNOP00000011869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]