SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000011971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000011971
Domain Number 1 Region: 89-191
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.52e-29
Family Iojap/YbeB-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000011971
Sequence length 229
Comment (Rattus norvegicus)
Sequence
MGPGWSPARRVWPLLWRRVFSQRASPKVSSVPWLPRLAERWLLAGPATCLTPTPSPRGLH
HGPQPEERTEGDARLQPGAADHIGAKFDIDMLVSLLKQENARDICVIKVPPEMRYTDYFV
IGSGTSTRHLHAMVHYIVKTYKHLKCRSDPYVKIEGKDTDDWLCVDFGSMVIHLMLPETR
ETYELEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTPMEFKCK
Download sequence
Identical sequences D3ZZ37
ENSRNOP00000011971 10116.ENSRNOP00000011971 ENSRNOP00000011971 NP_001100063.1.100692 NP_001100063.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]