SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000012092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000012092
Domain Number 1 Region: 22-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.96e-42
Family Pentraxin (pentaxin) 0.0000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000012092
Sequence length 228
Comment (Rattus norvegicus)
Sequence
MDKLLLWMSVFTSLLSEAFAQTDLNQKVFVFPRESETDYVKLIPWLEKPLQNFTLCFRAY
SDLSRSQSLFSYSVNSRDNELLIYKDKVGQYSLYIGNSKVTVRGLEEFPSPIHFCTSWES
SSGIAEFWVNGKPWVKKGLQKGYTVKSSPSIVLGQEQDTYGGGFDKTQSFVGEIADLYMW
DSVLTPENIHSVDRGFPPNPNILDWRALNYEINGYVVIKPRMWDNKSS
Download sequence
Identical sequences H6X320 P23680
ENSRNOP00000012092 10116.ENSRNOP00000012092 ENSRNOP00000012092 NP_058866.2.100692 NP_058866.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]