SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000012334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000012334
Domain Number 1 Region: 39-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-39
Family Laminin G-like module 0.015
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000012334
Domain Number - Region: 1631-1686
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.011
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000012334
Sequence length 1840
Comment (Rattus norvegicus)
Sequence
MDVHTRWKAPRPGAPLLSSPLLLLLLLLWAPPPSRAAQPTDLLEMLDFHNLPSGVTKTTG
FCATRRSSKEPDVAYRVSKDAQLSMPTKQLYPESDFPEDFSILTTVKAKKGSQAFLVSVY
NEQGIQQLGLELGRSPVFLYEDHTGKPGPEEYPLFPGINLSDGKWHRIAISVYKKNVTLI
LDCKKKITKFLNRGDHPIIDVNGIIMFGSRILDDEIFEGDIQQLLFVSDHRAAYDYCEHY
SPDCDTAVPDTPQSQDPNPDEYYPEGEGETYYYEYPYYEDPEDPGKEPAPSQKPVEAARE
TTEVPEEQTQPPSEAPTVPETSDTAGKEDNPGIGDYDYVPTDDYYTTSPYEDFGYGEGVE
NPDQPTNPDSGAEIPTSTSVTSNSSNPAPSPEEGKDDLGGEFTEETIKNLDENYYDPYFD
PDSDSNVSPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAG
LPGPPGTTGPTGQMGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPM
VSAQESQAQAILQQARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEPGDMGPQGPRGVQG
PPGPTGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGLPG
DDGERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPKGNVGPQGEPG
PPGQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQG
PPGPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRG
EDGPEGPKGRGGPNGDPGPLGPTGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKG
GRGTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTG
FPGPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPG
PPGPPGEQGLPGAAGKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGSEG
PPGPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGVPGEKGPQGPAGRDGLQG
PVGLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADG
EPGPRGQQGLFGQKGDEGSRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRG
PSGAPGADGPQGPPGGIGNPGAVGEKGEPGEAGEPGLPGEGGPLGPKGERGEKGEAGPSG
AAGPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPG
PTGEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDG
LRGIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQG
EKGDRGLPGPQGSSGPKGEQGITGPSGPLGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAG
HPGLPGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGAGESYVDYADGMEEIFGSLNSL
KLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGS
TCVFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASA
QQNITYNCYQSVAWQDAATGSYDKAIRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKT
VLEIDTPKVEQVPIVDIMFTDFGEASQKFGFEVGPACFLG
Download sequence
Identical sequences G3V763
ENSRNOP00000012334 10116.ENSRNOP00000012334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]