SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000013274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10116.ENSRNOP00000013274
Domain Number - Region: 44-85
Classification Level Classification E-value
Superfamily EF-hand 0.00575
Family EF-hand modules in multidomain proteins 0.083
Further Details:      
 
Domain Number - Region: 277-304
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0981
Family Triple coiled coil domain of C-type lectins 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000013274
Sequence length 304
Comment (Rattus norvegicus)
Sequence
MESSAGDPYRRPARRAQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQEVFHHLDCRGA
GRLPRADFRALCAVLGLNADGEAAKEDANSTEVAAKNPATGMIAGGDADVREEALLALRA
DPPELTFRQFHARLCGYFSSRAGSRLPRGALSEHIETQIRLRRPRRRRRPGSPSLHGGAY
GERVAHLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQSDIPEAAAHELQRAQGA
LAEAEARARRLQRGQVEVRLRTEEARQAVRRSLHRVRELESLARRVPRLQRQVQRLEAEL
RRYR
Download sequence
Identical sequences 10116.ENSRNOP00000013274 ENSRNOP00000013274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]