SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000014552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000014552
Domain Number 1 Region: 957-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-103
Family Thrombospondin C-terminal domain 0.00000000559
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-38
Family Laminin G-like module 0.0000119
Further Details:      
 
Domain Number 3 Region: 834-956
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.79e-36
Family TSP type-3 repeat 0.000000541
Further Details:      
 
Domain Number 4 Region: 765-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.18e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.44e-16
Family TSP-1 type 1 repeat 0.0000973
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000196
Family TSP-1 type 1 repeat 0.0000908
Further Details:      
 
Domain Number 7 Region: 692-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000262
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000711
Family VWC domain 0.0035
Further Details:      
 
Domain Number 9 Region: 381-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 10 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000014552
Sequence length 1172
Comment (Rattus norvegicus)
Sequence
MLWALALLALGIGPRAYAGDHGEDTAFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYVPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGHQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEADKSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCNQITCSPATC
ANPSLVEGECCPSCSHSADNDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKACQRAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVADI
CFSINKASRCVNTNPGFHCLPCPPRYKGTQPFGIGLEDAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNSNLVCATNATYHCVKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCPLLFNPRQLDYDKDEVGDRCDNCP
YVHNQAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQMDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRGE
Download sequence
Identical sequences ENSRNOP00000014552 10116.ENSRNOP00000014552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]