SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000015570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000015570
Domain Number 1 Region: 315-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000828
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000015570
Sequence length 957
Comment (Rattus norvegicus)
Sequence
MTLLLVSLLLASLLQISSGNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDG
ANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQI
CYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPA
GLGSGPQDGLSDHFTLSFWMKHSVTPSKGKKEEETIVCNTIQNEDGYSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALIHDNGLIH
PPRREPALMIGACWSEEKNKEKEKGGENSTDTTSGDPLPIHHYFHGYLAGFSVRSGRLES
REVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTL
RFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFE
GPEGVPLFPDLQITCSISHQVEAKADESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDP
ERESLLLDMASLQQRGLELTNTSAYLTIAGVETITVYEEILRQVHYQLRHGAALYARKFR
LSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSH
RNSMVPSAATLIIVVCVGFLVLMVILGLVRIHSLHRRVSGTGGPSGASADPKDPDLFWDD
SALTIIVNPMESYQNQQTGVAGVAGGQQEEEDSSDSEAADSPSSDERRIIESPPHRY
Download sequence
Identical sequences G3V7J1
ENSRNOP00000015570 ENSRNOP00000015570 10116.ENSRNOP00000015570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]