SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000016163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000016163
Domain Number 1 Region: 345-414
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000885
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000519
Further Details:      
 
Domain Number 2 Region: 415-485
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000182
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000016163
Domain Number - Region: 186-299
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0256
Family MBT repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000016163
Sequence length 654
Comment (Rattus norvegicus)
Sequence
RRQGEVEAVERQRQQRVPGLRQQRGRRRAEAEVTKAAAAAAVSLTVAETKAAAAADGERP
GPGPLLVGCSRAAVGPARLPPPAAPPPAPPPGRRRGPGPARTQGSVSAAAGAVGGGGGAM
GGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLPP
PADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLER
LRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCIFLNITDSELFIL
STTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLMG
LAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPRN
LVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQALL
EYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGGSGGGSDKAGYTTDESSSSSL
HTTRTYGGSYGGRGRGRRTGGPAYGPSSDPSTASETESEKREESNRAGPGDRDPPSRGEE
SRRRPIGGRGRGPPPVPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPVDS
Download sequence
Identical sequences 10116.ENSRNOP00000016163 ENSRNOP00000016163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]