SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000016579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000016579
Domain Number 1 Region: 60-180
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.98e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000016579
Sequence length 349
Comment (Rattus norvegicus)
Sequence
MGEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGRKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEESGRGRGIRGRGIRITPTAPSRGRGGAVPPPPPPGRGVLTPRGTTVTRGALPVPPVAR
GVPTPRARGTAAVPGYRAPPPPAPEAYEEYGYDDGYGGEYDDQTYEAYDNSYVTPTQSVP
EYYDYGHGVNEDAYDSYAPEEWTTTRSSLKAPPPRSARGGYREHPYGRY
Download sequence
Identical sequences Q920F3
ENSRNOP00000016579 10116.ENSRNOP00000016579 NP_579852.1.100692 NP_579852.1.4139 ENSRNOP00000016579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]