SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000018116 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000018116
Domain Number 1 Region: 55-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-31
Family Laminin G-like module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000018116
Sequence length 921
Comment (Rattus norvegicus)
Sequence
MKNFWKIPLFFFACSFLGPCVSATPKRRARFPANSVSHGGSELCPKIRIGQDDLPGFDLI
SQFQIEKAASRRTIQRVVGSTALQVAYKLGSNVDFRIPTRHLYPSGLPEEYSFLTTFRMT
GSTLEKQWNIWQIQDSSGREQVGVKINGQTKSVAFSYKGLDGSLQTAAFLNLQSLFDSRW
HKLMIGVERTRATLFIDCIQIDSLPIKPRAQIDADGFAVLGKLVDNPQVSVPFELQWMLI
HCDPLRPRRETCHELPVRITTSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPPGDPGKPGAPGKPGTPGADGLTGPDGSPGSVGPRGQKGEPGVPGSRGFPGRGIP
GPPGPPGTTGLPGELGRVGPAGDPGKRGPPGPPGPPGPSGTIGFHDGDPLCPNSCPPGRS
GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDK
GEKGARGFDGDPGPQGVPGAAGDQGQRGPPGETGPKGDRGIQGSRGIPGSPGPKGDTGLP
GVDGRDGIPGMPGTKGEAGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGNTGPPGKPGQL
GSSGKPGQQGPPGEVGPRGPRGLPGSRGPVGPEGSPGIPGKLGPLGSPGLPGLPGPPGLP
GMKGDRGVFGEPGPKGEQNATFKVGDLGAYGDMGDMGQPGPKGSVGNPGEPGLRGPEGIR
GLPGVEGPRGPPGPRGVQGEQGATGLPGIQGPPGRAPTDQHIKQVCMRVVQEHFAEMAAS
LKRPDTGASGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK
GERGPPGRGPKGLPGAIGLPGDPGPASYGKNGRDGEQGPPGVAGIPGVPGPPGPPGPPGF
CEPASCTLQAGQRAFSKGPDK
Download sequence
Identical sequences ENSRNOP00000018116 10116.ENSRNOP00000018116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]