SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000018844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000018844
Domain Number 1 Region: 344-570
Classification Level Classification E-value
Superfamily vWA-like 1.04e-60
Family Integrin A (or I) domain 0.00034
Further Details:      
 
Domain Number 2 Region: 6-217
Classification Level Classification E-value
Superfamily vWA-like 6.94e-55
Family Integrin A (or I) domain 0.00023
Further Details:      
 
Domain Number 3 Region: 219-345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000675
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 580-620
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000051
Family Chicken cartilage matrix protein 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000018844
Sequence length 624
Comment (Rattus norvegicus)
Sequence
MKGPFCWPLPLLLLFLQSWETQLQPAGPRCYTGPLDLVFMIDSSRSVRPFEFETMRQFLV
GLLHSLDVGLNATRVGVIQYSSQVQSVFPLGAFSNREDMERAIRAVVPLAQGTMTGLAIQ
YAMNVAFSEAEGARPSEERVPRVLVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADV
GSLRAMASPPLDQHVFLVESFDLIQEFGLQFQGRLCGKDLCAELEHGCQHLCVNAPGTFY
CACNSGYKLAPDNRNCLAIDLCAEGTHGCEHLCVSSVDSYFCRCRAGFALQQDQRSCRAI
DYCSFGNHSCQHECVSTLVGPQCRCREGHDLLPDGRSCQVRDFCNGVDHGCEFQCVSEGL
SFHCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSVRPQNFELVKRFVNQIVDFLDV
SPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYMERGTMTGLALRHMVEHSFS
EVQGARPRDLNVPRVGLVFTDGRSQDDISVWAARAKEEGIVMYAVGVGKAVEEELREIAS
EPSELHVSYSPDFNTMTHLLENLKGSICPEEGISAGTELRSPCECESLVEFQGRTLGALE
SLTQNLARLTERLEELENQLASRK
Download sequence
Identical sequences D3ZMS3
NP_001100009.1.100692 NP_001100009.1.4139 10116.ENSRNOP00000018844 ENSRNOP00000018844 ENSRNOP00000050126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]