SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000019026 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000019026
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.99e-24
Family THAP domain 0.00023
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000019026
Domain Number - Region: 120-179
Classification Level Classification E-value
Superfamily Prefoldin 0.000759
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000019026
Sequence length 210
Comment (Rattus norvegicus)
Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKQWEAAVRRKNFKPTKYSSICSEHFTP
DCFKRECNNKLLKENAVPTIFLYIEPHEKKEELEPQEQLPSPSPPTSQVDAAVGLLMPPL
QTPDNLSVFCDHNYTVEDTMHQRKRILHLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEV
VHFQREKDDASERGYVILPNDYFEIVEVPA
Download sequence
Identical sequences Q5U208
NP_001008341.1.100692 NP_001008341.1.4139 ENSRNOP00000019026 10116.ENSRNOP00000019026 ENSRNOP00000019026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]