SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000020145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000020145
Domain Number 1 Region: 510-688
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-45
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 2 Region: 167-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.16e-16
Family B-box zinc-binding domain 0.0000157
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000166
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 4 Region: 375-423,467-515
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000329
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000020145
Domain Number - Region: 114-162
Classification Level Classification E-value
Superfamily RING/U-box 0.00494
Family ZZ domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000020145
Sequence length 717
Comment (Rattus norvegicus)
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEPITAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPGSAMSSERIACQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVSDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVA
NCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATASSQVLIPDINFNDAFE
NFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTI
FTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGKCLYNSVDSWMIVPNIKQNHY
TVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEK
DESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWI
GKNASSWVFSRCNSHFVVRHNNKEMLVDVPPQLKRLGVLLDYDNNMLSFYDPANSLHLHT
FDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences ENSRNOP00000020145 10116.ENSRNOP00000020145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]