SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000020181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000020181
Domain Number 1 Region: 335-491,536-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-46
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000020181
Domain Number - Region: 106-154
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.013
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000020181
Sequence length 623
Comment (Rattus norvegicus)
Sequence
MAATGVGPGPGVGAGSGPGAAASATTTEDRETEPATAGAGEGPSAAPGAEPSSGEAESGD
ANLVDVSGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFT
ADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDE
HPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSK
DPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSASGNLNGGIAAGSSGKGRGAKRKQQDG
GTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAG
KPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEI
TVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDV
LGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYK
NGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDVTYHPMSDMGWGAVVEH
TLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences D3ZTV7
10116.ENSRNOP00000020181 NP_001099559.1.100692 NP_001099559.1.4139 ENSRNOP00000020181 ENSRNOP00000020181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]