SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000020379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000020379
Domain Number 1 Region: 332-453
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000020379
Domain Number - Region: 56-89
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0811
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000020379
Sequence length 456
Comment (Rattus norvegicus)
Sequence
MEPTPDAEEAHTVREALGRYEAALEGAVRALHEDMQGLQRGVERRVAEALRLAGPLARTV
AELQRDNQRLQAQLERLTRQVEALGLATGVSPAPGTPSPPPATTVTDRAPRLGTARFSSH
ATFSLSGRSPSMEHDEVSDLEARRTSNSCIMENGHQLDAGSANGSSEVQASSAQESPRPR
PVSLSLRLPHQPVTAVTRVSEKFSGETSASALSPTSAAIVGGFTPSPSEAISPWTPSPTE
KSSSFTRSLSGSGYGAVTAGKRKDSPPLVTPPQSPPSSQPPAMTQAPRQGERRRELVRSQ
TLPRTSGAQARKALFEKWEQDTASKGKGETRAKLKRSQSFGVASASSIKQILLEWCRSKT
VGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANC
ERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences D3ZUC1
10116.ENSRNOP00000020379 ENSRNOP00000020379 ENSRNOP00000020379 NP_001177927.1.100692 NP_001177927.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]