SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000021077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000021077
Domain Number 1 Region: 91-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-56
Family SPRY domain 0.0000012
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000012
Family RING finger domain, C3HC4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000021077
Sequence length 285
Comment (Rattus norvegicus)
Sequence
MAHFFKENSSCYFCFRYLENPVYLNCGYICCFQCLDSLEKSPEGDGVLCPNCSVVSLKED
IRHAKQLRNLVTTVKDLEPQLNFILTMDPSMKIFQVNMILDVDTAQNNLIISEDLRSVYH
TSQTQDRKKCAERFDPSPCVLGSSRFTSGCHYWEVVVGTSKEWDIGICKESINRQEVVYL
SEKKGFWTVGVRNEEVYAASTDPLTVLLVNPRLHRVGIFLDLLEKSVSFWDLGDGSHIYT
FLEIPDTEPFRPFFSPANTYPDEEQVISICPVMNPSIFGLPVNPV
Download sequence
Identical sequences D4ABM4
NP_001099692.1.100692 NP_001099692.1.4139 ENSRNOP00000021077 ENSRNOP00000021077 10116.ENSRNOP00000021077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]