SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000021340 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000021340
Domain Number 1 Region: 30-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-27
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 478-584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000345
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 682-754
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000251
Family VWC domain 0.034
Further Details:      
 
Domain Number 5 Region: 427-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000457
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 589-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000135
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 334-392
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000565
Family VWC domain 0.025
Further Details:      
 
Weak hits

Sequence:  10116.ENSRNOP00000021340
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00794
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 767-802
Classification Level Classification E-value
Superfamily FnI-like domain 0.0126
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000021340
Sequence length 810
Comment (Rattus norvegicus)
Sequence
MPMDVILVLWFCVCTARTVLGFGMDPDLQLDIISELDLVNTTLGVTQVAGLHNASKAFLF
QVITSKVSSANHASQHLCVLFSQASEFGFVLNVPQPPSTSQPSKNLCSFMCSYFELESSG
PREEIRYHYIHGGKPRTEALPYRMADGQWHKVALSVSASHLLLHIDCNRIYERVIDPPET
NLPPGSNLWLGQRNQKHGFFKGIIQDGKIIFMPNGFITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLGQLENCHCEKTCQVSGLLYRDQDSWVDGDNCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHISGQCCKVCRPKCIYGGKVLAEGQRILTKTCRECRGGV
LVKITEACPPLNCSAKDHILPENQCCRVCPGHNFCAEAPKCGENSECKNWNTKATCECKN
GYISVQGNSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDDC
GSGQHNCDKNAICTNTVQGHSCTCQPGYVGNGTICKAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECAEGFVECHNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDEC
ALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVWILREDRCSVCSCK
DGKIFCRRTACDCQNPNVDLFCCPECDTRVTSQCLDQSGQKLYRSGDNWTHSCQQCRCLE
GEADCWPLACPSLGCEYTAMFEGECCPRCVSDPCLADNIAYDIRKTCLDSFGVSRLSGAV
WTMAGSPCTTCKCKNGRVCCSVDLECIENN
Download sequence
Identical sequences ENSRNOP00000052883 10116.ENSRNOP00000021340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]