SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10116.ENSRNOP00000022100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10116.ENSRNOP00000022100
Domain Number 1 Region: 344-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-23
Family Clostridium neurotoxins, the second last domain 0.047
Further Details:      
 
Domain Number 2 Region: 152-259
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0041
Further Details:      
 
Domain Number 3 Region: 37-164
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000443
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10116.ENSRNOP00000022100
Sequence length 981
Comment (Rattus norvegicus)
Sequence
MLRRPAPALARAVRLLLAGLLYGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLI
ALDKDSPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGIIRSKEKLDCEL
QKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSYKAAVVEGKQHG
SILRVEAVDADCSPQFSQICSYEILTPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAY
DCGKKRATEDVLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVFPSIHLETCDEPVASVQ
ATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTSELLPSPSSSFNWTVGLPTDNGHDSD
QVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL
YVHGCRLIFLLRQDPSEEKKYRPAEFHWKLNQVCDEDWHHFVLNVEVPSVTLYVDGVSHE
PFSVTEDYPLHPTKIETQLVVGACWQEYSGVESGNETEPVTMASAGGDLHMTQFFRGNLA
GLTVRSGKLADKKVIDCLYTCKEGLDLQVPEDGNRGVQIQTSSSQAVLTLEGENVGELDK
AMQHISYLNSRQFPTPGIRRLKITSTVKCFNEAACIEVPPVEGYVMVLQPEEPKISLSGV
HHFARAASEFESPEGVSLFPELKIISTITREVEPEADGAEDPTVQESLVSEEIVHDLDTC
EVTVEGEELNAEQESLEVDVARLQQKGIEVNHSDLGVVFTGVETMASYEEVLHLLRYRNW
HTRSLLDRKFKLICSELNGRYLSNEFKVEVNVIHTANPVEHANHMAAQPQFVHPEHRSFV
DLSGHNLASPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHQRTMRDQDTGKENE
MDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEEEDITSAESESSEEEEGGP
GDGQNTTRQQQLEWDYSTLSY
Download sequence
Identical sequences 10116.ENSRNOP00000022100 ENSRNOP00000048535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]